Scyl3 Antibody - middle region : HRP

Scyl3 Antibody - middle region : HRP
SKU
AVIARP57775_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Scyl3 may play a role in regulating cell adhesion/migration complexes in migrating cells.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 81kDa

Peptide Sequence: Synthetic peptide located within the following region: NGLSDVKNTSEDNGSFPAGSNKPEEWPDWSEPEEPEQQPASIHRWPREPC

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein-associating with the carboxyl-terminal domain of ezrin

Protein Size: 735

Purification: Affinity Purified
More Information
SKU AVIARP57775_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57775_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig
Clonality Polyclonal
Application Western Blotting
Human Gene ID 240880
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×