SCYL3 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SCYL3 may play a role in regulating cell adhesion/migration complexes in migrating cells.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SCYL3

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 83kDa

Peptide Sequence: Synthetic peptide located within the following region: MGSENSALKSYTLREPPFTLPSGLAVYPAVLQDGKFASVFVYKRENEDKV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein-associating with the carboxyl-terminal domain of ezrin

Protein Size: 742

Purification: Affinity Purified

• SKU: AVIARP57774_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57774_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 57147
• Host: Rabbit