SEMA3D Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: SEMA3D induces the collapse and paralysis of neuronal growth cones. SEMA3D could potentially act as repulsive cues toward specific neuronal populations.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SEMA3D

Molecular Weight: 90kDa

Peptide Sequence: Synthetic peptide located within the following region: LECIPKSQQATIKWYIQRSGDEHREELKPDERIIKTEYGLLIRSLQKKDS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Semaphorin-3D

Protein Size: 777

Purification: Affinity Purified

• SKU: AVIARP55526_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55526_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 223117
• Host: Rabbit