SENP5 Antibody - middle region : HRP

SENP5 Antibody - middle region : HRP
SKU
AVIARP55489_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The reversible posttranslational modification of proteins by the addition of small ubiquitin-like SUMO proteins (see SUMO1; MIM 601912) is required for numerous biologic processes. SUMO-specific proteases, such as SENP5, are responsible for the initial processing of SUMO precursors to generate a C-terminal diglycine motif required for the conjugation reaction. They also have isopeptidase activity for the removal of SUMO from high molecular mass SUMO conjugates.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SENP5

Key Reference: Gong,L. (2006) J. Biol. Chem. 281 (23), 15869-15877

Molecular Weight: 87kDa

Peptide Sequence: Synthetic peptide located within the following region: LSGFLDEVMKKYGSLVPLSEKEVLGRLKDVFNEDFSNRKPFINREITNYR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Sentrin-specific protease 5

Protein Size: 755

Purification: Affinity Purified
More Information
SKU AVIARP55489_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55489_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 205564
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×