SERINC2 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SERINC2

Key Reference: Player,A., (2003) Int. J. Cancer 107 (2), 238-243

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: VCEEGAGIPTVLQGHIDCGSLLGYRAVYRMCFATAAFFFFFTLLMLCVSS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Serine incorporator 2

Protein Size: 455

Purification: Affinity Purified

• SKU: AVIARP55789_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55789_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 347735
• Host: Rabbit