SERPINF2 Antibody - N-terminal region : HRP

SERPINF2 Antibody - N-terminal region : HRP
SKU
AVIARP59189_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a member of the serpin family of serine protease inhibitors. The protein is a major inhibitor of plasmin, which degrades fibrin and various other proteins. Consequently, the proper function of this gene has a major role in regulating the blood clotting pathway. Mutations in this gene result in alpha-2-plasmin inhibitor deficiency, which is characterized by severe hemorrhagic diathesis. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SERPINF2

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: CSRDPTPEQTHRLARAMMAFTADLFSLVAQTSTCPNLILSPLSVALALSH

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Alpha-2-antiplasmin

Protein Size: 491

Purification: Affinity Purified
More Information
SKU AVIARP59189_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP59189_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 5345
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×