SETD4 Antibody - C-terminal region : Biotin

SETD4 Antibody - C-terminal region : Biotin
SKU
AVIARP58045_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human SETD4

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: NAVLQKVSHMKDEKEALINQLTLVESLWTEELKILRASAETLHSLQTAFT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: SET domain-containing protein 4

Protein Size: 440

Purification: Affinity purified
More Information
SKU AVIARP58045_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58045_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 54093
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×