SFRP2 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: SFRP2 is a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. SFRPs act as soluble modulators of Wnt signaling. Methylation of this gene is a potential marker for the presence of colorectal cancer.This gene encodes a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. SFRPs act as soluble modulators of Wnt signaling. Methylation of this gene is a potential marker for the presence of colorectal cancer. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SFRP2

Key Reference: Elston,M.S., (2008) Endocrinology 149 (3), 1235-1242

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: DRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Secreted frizzled-related protein 2

Protein Size: 295

Purification: Affinity Purified

• SKU: AVIARP56543_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56543_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 6423
• Host: Rabbit