SGK3 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of the protein remains unknown.This gene is a member of the Ser/Thr protein kinase family and encodes a phosphoprotein with a PX (phox homology) domain. The protein phosphorylates several target proteins and has a role in neutral amino acid transport and activation of potassium and chloride channels. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SGK3

Key Reference: Slagsvold,T., (2006) EMBO J. 25 (16), 3738-3749

Molecular Weight: 53kDa

Peptide Sequence: Synthetic peptide located within the following region: LYNHPDVRAFLQMDSPKHQSDPSEDEDERSSQKLHSTSQNINLGPSGNPH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 464

Purification: Affinity Purified

• SKU: AVIARP55612_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55612_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 23678
• Host: Rabbit