SGMS1 Antibody - middle region : Biotin

SGMS1 Antibody - middle region : Biotin
SKU
AVIARP55475_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: SGMS1 is predicted to be a five-pass transmembrane protein. This gene may be predominately expressed in brain.The protein encoded by this gene is predicted to be a five-pass transmembrane protein. This gene may be predominately expressed in brain. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SGMS1

Key Reference: Ding,T., (2008) J. Lipid Res. 49 (2), 376-385

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: SCFVLTTVMISVVHERVPPKEVQPPLPDTFFDHFNRVQWAFSICEINGMI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phosphatidylcholine:ceramide cholinephosphotransferase 1

Protein Size: 413

Purification: Affinity Purified
More Information
SKU AVIARP55475_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55475_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 259230
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×