SHB Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SHB is the adapter protein which regulates several signal transduction cascades by linking activated receptors to downstream signaling components. SHB may play a role in angiogenesis by regulating FGFR1, VEGFR2 and PDGFR signaling. SHB may also play a role in T-cell antigen receptor/TCR signaling, interleukin-2 signaling, apoptosis and neuronal cells differentiation by mediating basic-FGF and NGF-induced signaling cascades. SHB may also regulate IRS1 and IRS2 signaling in insulin-producing cells.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SHB

Key Reference: Kriz,V., (2006) J. Biol. Chem. 281 (45), 34484-34491

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: ERPSQPPQAVPQASSAASASCGPATASCFSASSGSLPDDSGSTSDLIRAY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: SH2 domain-containing adapter protein B

Protein Size: 509

Purification: Affinity Purified

• SKU: AVIARP58763_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58763_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 6461
• Host: Rabbit