Shc3 Antibody - N-terminal region : FITC

Shc3 Antibody - N-terminal region : FITC
SKU
AVIARP56957_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Shc3 is a signaling adapter that couples activated growth factor receptors to signaling pathway in neurons. It is involved in the signal transduction pathways of neurotrophin-activated Trk receptors in cortical neurons.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: PSKMLSSILGKSNLQFAGMSISLTISTASLNLRTPDSKQIIANHHMRSIS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: SHC-transforming protein 3

Protein Size: 474

Purification: Affinity Purified
More Information
SKU AVIARP56957_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56957_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 20418
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×