Shpk Antibody - middle region : Biotin

Shpk Antibody - middle region : Biotin
SKU
AVIARP54925_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: NGGNVLATFVHMLVQWMADLGLEVEESTVYSRMIQAAAQQKDTHLTITPT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Sedoheptulokinase

Protein Size: 476

Purification: Affinity Purified
More Information
SKU AVIARP54925_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54925_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 74637
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×