SIPA1 Antibody - middle region : FITC

SIPA1 Antibody - middle region : FITC
SKU
AVIARP58780_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The product of this gene is a mitogen induced GTPase activating protein (GAP). It exhibits a specific GAP activity for Ras-related regulatory proteins Rap1 and Rap2, but not for Ran or other small GTPases. This protein may also hamper mitogen-induced cell

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SIPA1

Key Reference: Lee,Y.J., (2008) Int. J. Dev. Biol. 52 (1), 43-53

Molecular Weight: 112kDa

Peptide Sequence: Synthetic peptide located within the following region: TAKPSVPSADSETPLTQDRPGSPSGSEDKGNPAPELRASFLPRTLSLRNS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Signal-induced proliferation-associated protein 1

Protein Size: 1042

Purification: Affinity Purified
More Information
SKU AVIARP58780_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58780_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 6494
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×