SKIL Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SKIL belongs to the SKI family and may have regulatory role in cell division or differentiation in response to extracellular signals.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SKIL

Molecular Weight: 70kDa

Peptide Sequence: Synthetic peptide located within the following region: LQNEHAQRMEEFYVEQKDLEKKLEQIMKQKCTCDSNLEKDKEAEYAGQLA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ski-like protein

Protein Size: 638

Purification: Affinity Purified

• SKU: AVIARP58074_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58074_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 6498
• Host: Rabbit