SLC26A5 antibody

SLC26A5 antibody
SKU
GTX04614-100
Packaging Unit
100 μl
Manufacturer
GeneTex

Availability: loading...
Price is loading...
Calculated MW: 81

Form: Liquid

Buffer (with preservative): PBS, 2% sucrose, 0.09% sodium azide.

Concentration: 1 mg/ml (Please refer to the vial label for the specific concentration.)

Background: This gene encodes a member of the SLC26A/SulP transporter family. The protein functions as a molecular motor in motile outer hair cells (OHCs) of the cochlea, inducing changes in cell length that act to amplify sound levels. The transmembrane protein is an incomplete anion transporter, and does not allow anions to cross the cell membrane but instead undergoes a conformational change in response to changes in intracellular Cl- levels that results in a change in cell length. The protein functions at microsecond rates, which is several orders of magnitude faster than conventional molecular motor proteins. Mutations in this gene are potential candidates for causing neurosensory deafness. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Nov 2009]

Uniprot ID: P58743

Antigen Species: Human

Immunogen: A synthetic peptide directed towards the middle region of human SLC26A5: FSVTISMAKTLANKHGYQVDGNQELIALGLCNSIGSLFQTFSISCSLSRS

Purification: Protein A purified

Conjugation: Unconjugated

Full Name: solute carrier family 26 member 5
More Information
SKU GTX04614-100
Manufacturer GeneTex
Manufacturer SKU GTX04614-100
Green Labware No
Package Unit 100 μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Immunohistochemistry (paraffin), Western Blotting
Isotype IgG
Human Gene ID 375611
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×