SMAP1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGPRWASWNIGV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: stromal membrane-associated protein 1

Protein Size: 467

Purification: Affinity Purified

• SKU: AVIARP56281_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56281_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 684800
• Host: Rabbit