Smarcd3 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Smarcd3 plays a role in ATP dependent nucleosome remodeling by SMARCA4 containing complexes. It stimulates nuclear receptor mediated transcription. It belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a post-mitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to post-mitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth.

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: DLKVMTDVAGNPEEERRAEFYHQPWSQEAVSRYFYCKIQQRRQELEQSLV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3

Protein Size: 483

Purification: Affinity Purified

• SKU: AVIARP58323_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58323_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 66993
• Host: Rabbit