SMU1 Antibody - N-terminal region : Biotin

SMU1 Antibody - N-terminal region : Biotin
SKU
AVIARP57160_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SMU1

Key Reference: 0

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: KQTQPERYIHLENLLARSYFDPREAYPDGSSKEKRRAAIAQALAGEVSVV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: WD40 repeat-containing protein SMU1

Protein Size: 513

Purification: Affinity Purified
More Information
SKU AVIARP57160_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57160_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55234
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×