SNRK Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: SNRK may play a role in hematopoietic cell proliferation or differentiation. SNRK is the potential mediator of neuronal apoptosis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SNRK

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 84kDa

Peptide Sequence: Synthetic peptide located within the following region: SSSETSDDDSESRRRLDKDSGFTYSWHRRDSSEGPPGSEGDGGGQSKPSN

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: SNF-related serine/threonine-protein kinase

Protein Size: 765

Purification: Affinity Purified

• SKU: AVIARP56306_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56306_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 54861
• Host: Rabbit