SPATA2 Antibody - C-terminal region : HRP

SPATA2 Antibody - C-terminal region : HRP
SKU
AVIARP59150_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: SPATA2 may have a role in the regulation of spermatogenesis.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SPATA2

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: DRLPHLHSKSKPSTTPTSRCGFCNRPGATNTCTQCSKVSCDACLSAYHYD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Spermatogenesis-associated protein 2

Protein Size: 520

Purification: Affinity Purified
More Information
SKU AVIARP59150_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP59150_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 9825
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×