SPDYE1 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene is located at chromosome 7p13 which is close to the Williams Beuren syndrome chromosome region 7q11.23.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human SPDYE1

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: RCMNPRARKNRSQIVLFQKRRFHFFCSMSCRAWVSPEELEEIQAYDPEHW

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Speedy protein E1

Protein Size: 336

Purification: Affinity Purified

• SKU: AVIARP57845_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57845_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 285955
• Host: Rabbit