SPNS2 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SPNS2 is the sphingolipid transporter required for migration of myocardial precursors. SPNS2 transports sphingosine 1-phosphate (S1P), a secreted lipid mediator that plays critical roles in cardiovascular, immunological, and neural development and function. SPNS2 mediates the export of S1P from cells in the extraembryonic yolk syncytial layer (YSL), thereby regulating myocardial precursor migration.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SPNS2

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: PPGTPGTPGCAATAKGPGAQQPKPASLGRGRGAAAAILSLGNVLNYLDRY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein spinster homolog 2

Protein Size: 549

Purification: Affinity Purified

• SKU: AVIARP56057_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56057_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 124976
• Host: Rabbit