STAMBPL1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: STAMBPL1 is a zinc metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains.STAMBPL1 does not cleave 'Lys-48'-linked polyubiquitin chains.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human STAMBPL1

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: MDQPFTVNSLKKLAAMPDHTDVSLSPEERVRALSKLGCNITISEDITPRR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: AMSH-like protease

Protein Size: 436

Purification: Affinity Purified

• SKU: AVIARP57453_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57453_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 57559
• Host: Rabbit