Stmn1 Antibody - N-terminal region : FITC

Stmn1 Antibody - N-terminal region : FITC
SKU
AVIARP58670_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Stmn1 is involved in the regulation of the microtubule (MT) filament system by destabilizing microtubules. Stmn1 prevents assembly and promotes disassembly of microtubules. Phosphorylation at Ser-16 may be required for axon formation during neurogenesis. Stmn1 is involved in the control of the learned and innate fear.

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: MASSDIQVKELEKRASGQAFELILSPRSKESVPDFPLSPPKKKDLSLEEI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Stathmin

Protein Size: 149

Purification: Affinity Purified
More Information
SKU AVIARP58670_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58670_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 16765
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×