SUSD3 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The exact function of SUSD3 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SUSD3

Key Reference: Humphray,S.J., (2004) Nature 429 (6990), 369-374

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: LRLPPQATFQVLRGNGASVGTVLMFRCPSNHQMVGSGLLTCTWKGSIAEW

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Sushi domain-containing protein 3

Protein Size: 255

Purification: Affinity Purified

• SKU: AVIARP55443_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55443_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Pig (Porcine), Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 203328
• Host: Rabbit