SYCP3 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: SYCP3 is a component of the transverse filaments of synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase. It has an essential meiotic function in spermatogenesis. SYCP3 may be important for testis development.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SYCP3

Key Reference: Bukovsky,A., (2008) Cell Cycle 7 (5), 683-686

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: VSSGKKYSRKSGKPSVEDQFTRAYDFETEDKKDLSGSEEDVIEGKTAVIE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Synaptonemal complex protein 3

Protein Size: 236

Purification: Affinity Purified

• SKU: AVIARP58334_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58334_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 50511
• Host: Rabbit