TBC1D22A Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: TBC1D22A contains 1 Rab-GAP TBC domain. It may act as a GTPase-activating protein for Rab family protein(s).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of TBC1D22A

Molecular Weight: 59kDa

Peptide Sequence: Synthetic peptide located within the following region: MTWKLLSGYLPANVDRRPATLQRKQKEYFAFIEHYYDSRNDEVHQDTYRQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: TBC1 domain family member 22A

Protein Size: 517

Purification: Affinity Purified

• SKU: AVIARP55030_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55030_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 25771
• Host: Rabbit