TBC1D24 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: TBC1D24 may act as a GTPase-activating protein for Rab family protein(s).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TBC1D24

Molecular Weight: 62kDa

Peptide Sequence: Synthetic peptide located within the following region: SDPADRLSPFLAARHFNLPSKTESMFMAGGSDCLIVGGGGGQALYIDGDL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: TBC1 domain family member 24

Protein Size: 553

Purification: Affinity Purified

• SKU: AVIARP57438_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57438_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 57465
• Host: Rabbit