TBC1D7 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: TBC1D7 belongs to a family of proteins sharing a 180- to 200-amino acid TBC domain presumed to have a role in regulating cell growth and differentiation. These proteins share significant homology with TRE2, yeast Bub2, and CDC16.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human TBC1D7

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: MYQLESGKLPRSPSFPLPKAFEQYLNLEDGRLLTHLRMCSAAPKLPYDLW

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: TBC1 domain family member 7

Protein Size: 247

Purification: Affinity Purified

• SKU: AVIARP56926_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56926_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 51256
• Host: Rabbit