Tdrd7 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: Tdrd7 binds to PCTAIRE 2, a Cdc2-related kinase expressed in the terminally differentiated neuron; contains five tudor-like domains; may mediate the regulation of mitochondrial function in the neurons.

Molecular Weight: 122kDa

Peptide Sequence: Synthetic peptide located within the following region: CSDCSIKVTKVDEARGVAYVYLFTPKNFPDPHRSINRQITNADLWKHQKD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tudor domain-containing protein 7

Protein Size: 1113

Purification: Affinity Purified

• SKU: AVIARP55002_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55002_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 85425
• Host: Rabbit