Terf2ip Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Terf2ip acts both as a regulator of telomere function and as a transcription regulator. It is involved in the regulation of telomere length and protection as a component of the shelterin complex (telosome). In contrast to other components of the shelterin complex, it is dispensible for telomere capping and does not participate in the protection of telomeres against non-homologous end-joining (NHEJ)-mediated repair. Instead, it is required to negatively regulate telomere recombination and is essential for repressing homology-directed repair (HDR), which can affect telomere length.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: LTYVKENARSPSSVTGNALWKAMEKSSLTQHSWQSLKDRYLKHLRGQEHK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Telomeric repeat-binding factor 2-interacting protein 1

Protein Size: 286

Purification: Affinity Purified

• SKU: AVIARP57301_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57301_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 57321
• Host: Rabbit