TESC Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human TESC

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: SEEVRELEGKTGFSSDQIEQLHRRFKQLSGDQPTIRKENFNNVPDLELNP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: calcineurin B homologous protein 3

Protein Size: 267

Purification: Affinity Purified

• SKU: AVIARP57059_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57059_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 54997
• Host: Rabbit