Tex11 Antibody - N-terminal region : Biotin

Tex11 Antibody - N-terminal region : Biotin
SKU
AVIARP56159_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Tex11

Molecular Weight: 109kDa

Peptide Sequence: Synthetic peptide located within the following region: SCHTETNLSLYKNTVEKGIFHVLSYQAESAVAQGDFKKASICVLRCKDML

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 946

Purification: Affinity Purified
More Information
SKU AVIARP56159_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56159_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 501588
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×