TEX47 Antibody - N-terminal region : Biotin

TEX47 Antibody - N-terminal region : Biotin
SKU
AVIARP55494_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MGC26647

Key Reference: Scherer,S.W., (2003) Science 300 (5620), 767-772

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: EEKQRLHLKKFLLDRMFLVAKIQANVERKDVADYYEQMFQSVLKHHLGEA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: testis-expressed protein 47

Protein Size: 253

Purification: Affinity Purified
More Information
SKU AVIARP55494_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55494_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 219557
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×