TEX47 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MGC26647

Key Reference: Scherer,S.W., (2003) Science 300 (5620), 767-772

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: EEKQRLHLKKFLLDRMFLVAKIQANVERKDVADYYEQMFQSVLKHHLGEA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: testis-expressed protein 47

Protein Size: 253

Purification: Affinity Purified

• SKU: AVIARP55494_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55494_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 219557
• Host: Rabbit