Tfam Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function remains unknown.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: LGKPKRPRSAYNIYVSESFQEAKDDSAQGKLKLVNEAWKNLSPEEKQAYI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Transcription factor A, mitochondrial

Protein Size: 243

Purification: Affinity Purified

• SKU: AVIARP58723_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58723_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Mouse (Murine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 21780
• Host: Rabbit