TFDP3 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TFDP3

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: PVVGSPNPPSTHFASQNQHSYSSPPWAGQHNRKGEKNGMGLCRLSMKVWE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Transcription factor Dp family member 3

Protein Size: 345

Purification: Affinity Purified

• SKU: AVIARP58170_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58170_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus), Rabbit, Guinea Pig
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 51270
• Host: Rabbit