TFDP3 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TFDP3

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: PVVGSPNPPSTHFASQNQHSYSSPPWAGQHNRKGEKNGMGLCRLSMKVWE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Transcription factor Dp family member 3

Protein Size: 345

Purification: Affinity Purified

• SKU: AVIARP58170_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58170_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus), Rabbit, Guinea Pig
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 51270
• Host: Rabbit