TH1L Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The NELF complex of proteins interacts with the DSIF protein complex to repress transcriptional elongation by RNA polymerase II. The protein encoded by this gene is an essential part of the NELF complex. Alternative translation initiation site usage results in the formation of two isoforms with different N-termini.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TH1L

Molecular Weight: 66kDa

Peptide Sequence: Synthetic peptide located within the following region: GEGEDDAEVQQECLHKFSTRDYIMEPSIFNTLKRYFQAGGSPENVIQLLS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Negative elongation factor C/D

Protein Size: 590

Purification: Affinity Purified

• SKU: AVIARP57805_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57805_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 51497
• Host: Rabbit