THEG Antibody - middle region : Biotin

THEG Antibody - middle region : Biotin
SKU
AVIARP57810_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene is specifically expressed in the nucleus of haploid male germ cells. It encodes a protein that may be involved in the regulation of germ cell nuclear functions. Alternatively spliced transcript variants encoding distinct isoforms have been reported.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human THEG

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: DRPSVYWTERFLEDTTLTITVPAVSRRVEELSRPKRFYLEYYNNNRTTPV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Testicular haploid expressed gene protein

Protein Size: 355

Purification: Affinity Purified
More Information
SKU AVIARP57810_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57810_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51298
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×