TLR2 Antibody - middle region : HRP

TLR2 Antibody - middle region : HRP
SKU
AVIARP59036_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: TLR2 is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is expressed most abundantly in peripheral blood leukocytes, and mediates host response to Gram-positive bacteria and yeast via stimulation of NF-kappaB.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TLR2

Molecular Weight: 90kDa

Peptide Sequence: Synthetic peptide located within the following region: VSGMCCALFLLILLTGVLCHRFHGLWYMKMMWAWLQAKRKPRKAPSRNIC

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Toll-like receptor 2

Protein Size: 784

Purification: Affinity Purified
More Information
SKU AVIARP59036_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP59036_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Cow (Bovine), Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Immunofluorescence, Western Blotting
Human Gene ID 7097
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×