TNF Antibody

TNF Antibody
SKU
ASBKC-066-100
Packaging Unit
100 μl
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Uniprot: P01375

Gene Name: TNF

Immunogen: Recombinant human TNF

Purity: ≥85%

Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide

Identity-Mouse (%): 79%

Core Sequence: SRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGI

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 79%, Rat - 78%

Alternative gene names: TNFA;TNFSF2

Alternative protein names: Tumor necrosis factor; Cachectin; TNF-alpha; Tumor necrosis factor ligand superfamily member 2; TNF-a) [Cleaved into: Tumor necrosis factor; membrane form; N-terminal fragment; NTF; Intracellular domain 1; ICD1; Intracellular domain 2; ICD2; C-domain 1; C-domain 2; Tumor necrosis factor; soluble form]

Protein name: Tumor necrosis factor

Product panel: Cytokines

Clone No.: K06288_6G6

Antigen Species: Human

Target Name: TNF

IHC Verification: -

IHC Dilution: N/A

WB Verification: succeed

WB Dilution: 1:1000

IP Verification: -

IP Dilution: N/A

IF Verification: -

IF Dilution: N/A

Sandwich ELISA Verification: -

Sandwich ELISA Dilution: N/A

Antigen ID: PP-478

Cross reactivity: Not tested
More Information
SKU ASBKC-066-100
Manufacturer Absea Biotechnology
Manufacturer SKU KC-066-100
Package Unit 100 μl
Quantity Unit STK
Reactivity Human
Clonality Monoclonal
Application Western Blotting
Isotype IgG1
Human Gene ID 7124
Host Mouse
Conjugate Unconjugated
Product information (PDF)
×
MSDS (PDF)
×