TNFSF13B Antibody - N-terminal region : HRP

TNFSF13B Antibody - N-terminal region : HRP
SKU
AVIARP58542_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptors TNFRSF13B/TACI, TNFRSF17/BCMA, and TNFRSF13C/BAFFR. This cytokine is expressed in B cell lineage cells, a

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TNFSF13B

Key Reference: Xing,X.W., (2003) Sheng Wu Hua Xue Yu Sheng Wu Wu Li Xue Bao 35 (3), 283-288

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: ALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Tumor necrosis factor ligand superfamily member 13B

Protein Size: 285

Purification: Affinity Purified
More Information
SKU AVIARP58542_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58542_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 10673
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×