TNFSF4 Antibody - middle region : HRP

TNFSF4 Antibody - middle region : HRP
SKU
AVIARP59092_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptor TNFRSF4/OX4. It is found to be involved in T cell antigen-presenting cell (APC) interactions. In surface Ig- and CD40-stimulated B cells, this cytokine along with CD70 has been shown to provide CD28-independent costimulatory signals to T cells. This protein and its receptor are reported to directly mediate adhesion of activated T cells to vascular endothelial cells.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TNFSF4

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: QEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Tumor necrosis factor ligand superfamily member 4

Protein Size: 183

Purification: Affinity Purified
More Information
SKU AVIARP59092_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP59092_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 7292
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×