TNPO2 Antibody - N-terminal region : FITC

TNPO2 Antibody - N-terminal region : FITC
SKU
AVIARP54955_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Transportin-2 (TNPO2) mediates nuclear import of HuR protein in vitro. It also participates in mRNA export from the nucleus.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TNPO2

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 100kDa

Peptide Sequence: Synthetic peptide located within the following region: MDWQPDEQGLQQVLQLLKDSQSPNTATQRIVQDKLKQLNQFPDFNNYLIF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Transportin-2

Protein Size: 887

Purification: Affinity Purified
More Information
SKU AVIARP54955_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54955_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 30000
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×