TRAPPC1 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene product plays a role in vesicular transport of proteins to the Golgi apparatus from the endoplasmic reticulum. The encoded protein is a component of the multisubunit transport protein particle (TRAPP) complex. Alternative splicing results in multiple transcript variants.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRAPPC1

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: YKLMYGMLFSIRSFVSKMSPLDMKDGFLAFQTSRYKLHYYETPTGIKVVM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Trafficking protein particle complex subunit 1

Protein Size: 145

Purification: Affinity Purified

Subunit: 1

• SKU: AVIARP57531_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57531_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 58485
• Host: Rabbit