TRIM15 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: TRIM15 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to the cytoplasm. Its function has not been identified. The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to the cytoplasm. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRIM15

Key Reference: Uchil,P.D., PLoS Pathog. 4 (2), E16 (2008)

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: HLEIDSGVITLDPQTASRSLVLSEDRKSVRYTRQKKSLPDSPLRFDGLPA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tripartite motif-containing protein 15

Protein Size: 465

Purification: Affinity Purified

• SKU: AVIARP58130_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58130_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Pig (Porcine), Rabbit, Cow (Bovine), Yeast
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 89870
• Host: Rabbit