TRIM25 Antibody - middle region : Biotin

TRIM25 Antibody - middle region : Biotin
SKU
AVIARP58105_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to the cytoplasm. The presence of potential DNA-binding and dimerization-transactivation domains suggests that this protein may act as a transcription factor, similar to several other members of the TRIM family. Expression of the gene is upregulated in response to estrogen, and it is thought to mediate estrogen actions in breast cancer as a primary response gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRIM25

Molecular Weight: 71kDa

Peptide Sequence: Synthetic peptide located within the following region: LLDASETTSTRKIKEEEKRVNSKFDTIYQILLKKKSEIQTLKEEIEQSLT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: E3 ubiquitin/ISG15 ligase TRIM25

Protein Size: 630

Purification: Affinity Purified
More Information
SKU AVIARP58105_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58105_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 7706
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×