TRIML2 Antibody - middle region : Biotin

TRIML2 Antibody - middle region : Biotin
SKU
AVIARP55636_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The specific function of TRIML2 is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRIML2

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: TEMSLIYNFSHCAFQGALRPVFSLCIPNGDTSPDSLTILQHGPSCDATVS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Probable E3 ubiquitin-protein ligase TRIML2

Protein Size: 387

Purification: Affinity Purified
More Information
SKU AVIARP55636_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55636_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 205860
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×